PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1DL_D1EC7DEA6.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 112aa    MW: 12605.9 Da    PI: 9.7148
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1DL_D1EC7DEA6.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY83.81.7e-2665111147
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTE CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkv 47 
                            ldDgy+WrKYGqK vk+s fprsYYrCt a+C vkk vers++dp++
  Traes_1DL_D1EC7DEA6.1  65 LDDGYRWRKYGQKAVKNSSFPRSYYRCTVARCGVKKLVERSQQDPST 111
                            59******************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.8E-2651112IPR003657WRKY domain
SuperFamilySSF1182907.72E-2358111IPR003657WRKY domain
PROSITE profilePS5081123.27360112IPR003657WRKY domain
SMARTSM007744.5E-2165112IPR003657WRKY domain
PfamPF031065.4E-2066111IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
GEAAGVESHG CKRGSPVPEE GDEDGSADHH NHRSDEKEQK KKGKWEKKAR GSRVAFATKS  60
EVDHLDDGYR WRKYGQKAVK NSSFPRSYYR CTVARCGVKK LVERSQQDPS TV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-21581121064Probable WRKY transcription factor 4
2lex_A3e-21581121064Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKR8273971e-138KR827397.1 Triticum aestivum WRKY46 transcriptional factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002441585.18e-36hypothetical protein SORBIDRAFT_09g029810
RefseqXP_014754332.15e-36PREDICTED: probable WRKY transcription factor 48
SwissprotO229007e-33WRK23_ARATH; Probable WRKY transcription factor 23
TrEMBLM8CVX09e-76M8CVX0_AEGTA; Putative WRKY transcription factor 23
TrEMBLW5AIN71e-77W5AIN7_WHEAT; Uncharacterized protein
STRINGMLOC_44947.15e-50(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.13e-32WRKY DNA-binding protein 23
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]